PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015878424.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family GRAS
Protein Properties Length: 633aa    MW: 69104.4 Da    PI: 6.9047
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015878424.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS326.17.1e-1002596332374
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdg..dpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                     ++ Lle+A a+s+g+ e a ++L+rls+ ++p++  ++ q++  + + AL++r++          pps  +e  s+e++ ++++++e+sP++k++
  XP_015878424.1 259 KQSLLEAASAISEGKPESAAEILTRLSQVSNPNQkpNSEQKVLEFTASALKSRVVP------GENPPS-VAELFSQEHAGSTQMLYELSPCFKLG 346
                     578**************************9999856799****************9......222332.3334599999**************** PP

            GRAS  95 hltaNqaIleavege...........ervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfef 178
                     +++aN aIlea+  e           +++H+iDf+i++G+Q+ +Ll+  a     p +++iT+v++  +g +e+l+ ++e L+++Ae+l+vp++f
  XP_015878424.1 347 FMAANLAILEATLAEqqstsnnkhnnNKLHVIDFEIGEGGQYRNLLHLVAP--VRPMMVKITTVAE--NGGEERLKLVRETLSQLAERLRVPLKF 437
                     **********9855445666666777899******************9994..67899********..77************************* PP

            GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdslea 273
                     nv v+++l +l+ e+L ++ +E l+Vn++++l+r++desvs+e++rde+L+ vk+l P+vv++veqe+++n+++F++rf e++ yy +l+ds+e+
  XP_015878424.1 438 NV-VSQKLGELTRESLGCEADEFLVVNFAFKLYRMPDESVSTENPRDELLRRVKGLGPRVVTLVEQELNTNTAPFMARFNETCAYYGVLLDSIES 531
                     *9.7******************************************************************************************* PP

            GRAS 274 klpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk..sdgyrveeesgslvlgWkdrp 366
                     ++pr++ +r+k E++ ++r++ n vaceg++r+er+e ++kWr+r+++aGF  v+ s+++a+++k+ l++ +  +  ++v+ee+g +++gW++r+
  XP_015878424.1 532 TVPRDNTDRVKAEEA-VSRKLGNSVACEGRDRVERCEVFGKWRARMGMAGFALVQSSQSVAESIKARLSTGNrfDPRFTVKEENGGVCFGWMGRT 625
                     ***************.9**************************************************9988874445****************** PP

            GRAS 367 LvsvSaWr 374
                     L+++SaWr
  XP_015878424.1 626 LTVASAWR 633
                     *******8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098543.958232611IPR005202Transcription factor GRAS
PfamPF035142.5E-97259633IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
Sequence ? help Back to Top
Protein Sequence    Length: 633 aa     Download sequence    Send to blast
MQSGFTGGGG VPDFYGAGRS IATTMNNASQ TPYHRSQLQG LFLDPTASQI ARQSPNTLVG  60
KRTLAEFQSH QQYQHHPTNQ GLANANFLRS VKPRTYQHSS PISPLSLIEF SSPGSETSST  120
SSSSSASSQQ QQRFGLPLLH KLRPQSISPA LPVGPYVNAV QNRVVGGGLA VDSSDKKMMD  180
HRLQELEKEL LDDNDEEEGD AVSVITNTNS EWSETIQNLI SPNQSQSQSQ SQKPVSPSPT  240
SSSSSSSSVA SPASSTCSKQ SLLEAASAIS EGKPESAAEI LTRLSQVSNP NQKPNSEQKV  300
LEFTASALKS RVVPGENPPS VAELFSQEHA GSTQMLYELS PCFKLGFMAA NLAILEATLA  360
EQQSTSNNKH NNNKLHVIDF EIGEGGQYRN LLHLVAPVRP MMVKITTVAE NGGEERLKLV  420
RETLSQLAER LRVPLKFNVV SQKLGELTRE SLGCEADEFL VVNFAFKLYR MPDESVSTEN  480
PRDELLRRVK GLGPRVVTLV EQELNTNTAP FMARFNETCA YYGVLLDSIE STVPRDNTDR  540
VKAEEAVSRK LGNSVACEGR DRVERCEVFG KWRARMGMAG FALVQSSQSV AESIKARLST  600
GNRFDPRFTV KEENGGVCFG WMGRTLTVAS AWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-282606336375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015878424.10.0PREDICTED: scarecrow-like protein 8
SwissprotQ9FYR71e-179SCL8_ARATH; Scarecrow-like protein 8
TrEMBLW9RDH00.0W9RDH0_9R
STRINGPOPTR_0004s07700.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62663151
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52510.11e-164SCARECROW-like 8